PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 377aa    MW: 41661 Da    PI: 8.3328
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109406.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.9e-32206261156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_010109406.1 206 KQRRNWSPELHKRFLNALQQLGGSHTATPKQIRELMKVDGLTNDEVKSHLQKYRLH 261
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-28203264IPR009057Homeodomain-like
PROSITE profilePS5129413.926203263IPR017930Myb domain
SuperFamilySSF466894.07E-18204264IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-27206261IPR006447Myb domain, plants
PfamPF002492.5E-8208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MDFSEKMNYS GLGFREYVET LEEERKKIQV FQKELPYCLE LVTQTIERCK QQLSGTATTT  60
ECLHGQSECS EQTSSEGRVF EEFLPLKRTS SDNEDDEDEE QQSPKRKTSI NNDNMADNKK  120
KADWLRSVQL WNNPTPDPAP QKEDVPKKAS VMEVKRNGGA FQPFQREKNV GKRNGSPAPA  180
PASAPAASSS SGKRDDETEG QQSQRKQRRN WSPELHKRFL NALQQLGGSH TATPKQIREL  240
MKVDGLTNDE VKSHLQKYRL HTRRPTPATP NNGNGQTPQV VFVGGIWVQP SEYAAAAASA  300
AALGDPSSVT TAANRIYAPV AAPPPAIQHM AVHRLQQKKQ SDSSHSEERI SHSGGVQHSN  360
SPATSSSTHT TTSSPAF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109406.10.0Two-component response regulator
TrEMBLW9S2C00.0W9S2C0_9R
STRINGVIT_01s0011g03110.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.12e-89G2-like family protein